DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and spg-7

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_491165.2 Gene:spg-7 / 171915 WormBaseID:WBGene00004978 Length:782 Species:Caenorhabditis elegans


Alignment Length:170 Identity:51/170 - (30%)
Similarity:81/170 - (47%) Gaps:20/170 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 IADCQD----------FIKSSLWYTQRGIPYRRGYLLYGPPGCGKSSFITALAGELEYSVCLLNL 257
            :|.|::          |:|:...|...|....:|.:|.||||.||:....|.|||.......::.
 Worm   295 VAGCEEAKIEIMEFVNFLKNPQQYKDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVSG 359

  Fly   258 SE-----RGLTDDRLNHLLNVAPEQS--IILLEDIDAAFVSREATPQQKSAFDGLNRITFSGLLN 315
            ||     .|:...|:..:.::|.:.|  |:.:::|||  |.|:...:...........|.:.||.
 Worm   360 SEFLEMFVGVGPARVRDMFSMARKNSPCILFIDEIDA--VGRKRGGKGGMGGHSEQENTLNQLLV 422

  Fly   316 CLDGVGSTEAR-IVFMTTNYIDRLDPALVRPGRIDLKEYI 354
            .:||..:.|:. ||...||.:|.||.||:||||.|.:.|:
 Worm   423 EMDGFTTDESSVIVIAATNRVDILDSALLRPGRFDRQIYV 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980
RecA-like_BCS1 202..354 CDD:410918 50/168 (30%)
spg-7NP_491165.2 FtsH_ext 123..218 CDD:310823
TIP49 278..731 CDD:332389 51/170 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0465
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.