DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4908 and Psmc1

DIOPT Version :9

Sequence 1:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_476464.1 Gene:Psmc1 / 117263 RGDID:621097 Length:440 Species:Rattus norvegicus


Alignment Length:344 Identity:93/344 - (27%)
Similarity:135/344 - (39%) Gaps:84/344 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 MITLEVPCRDKSYQWLLKWITIRGARKTQHLSVETNFVQNDNGTIKTSYDFIPSIGKHLFQYKGN 112
            ::|....||.|    |||...|:     .:|.:|..|::|..                  |.|. 
  Rat    51 LVTPHTQCRLK----LLKLERIK-----DYLLMEEEFIRNQE------------------QMKP- 87

  Fly   113 WIQVERTREQQTLDLHMGVPWETVTL------------TAFGNNKGIYF------DILEEARQLA 159
             ::.::..|:..:|...|.|....||            |:.|:...:..      |:||....:.
  Rat    88 -LEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVL 151

  Fly   160 L----EATEGKTV-----LYTAMGAEWRPFGHPRRRRPTGSVVLDRGTSQRIIADCQDFIKSSL- 214
            |    .|..|..:     |.|.|..|..|          .....|.|.....|.:.::.::..| 
  Rat   152 LNHKVHAVIGVLMDDTDPLVTVMKVEKAP----------QETYADIGGLDNQIQEIKESVELPLT 206

  Fly   215 ---WYTQRGIPYRRGYLLYGPPGCGKSSFITALAGELEYS---VCLLNLSERGLTD--DRLNHLL 271
               :|.:.||...:|.:||||||.||:....|:|.:...:   |....|.::.|.|  ..:..|.
  Rat   207 HPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELF 271

  Fly   272 NVAPEQ--SIILLEDIDAAFVSREATPQQKSAFDGLNRI--TFSGLLNCLDGVGSTEARIVFMTT 332
            .||.|.  ||:.:::|||.     .|.:..|...|...|  |...|||.|||..|.....|.|.|
  Rat   272 RVAEEHAPSIVFIDEIDAI-----GTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMAT 331

  Fly   333 NYIDRLDPALVRPGRIDLK 351
            |.|:.|||||:||||||.|
  Rat   332 NRIETLDPALIRPGRIDRK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980 33/170 (19%)
RecA-like_BCS1 202..354 CDD:410918 58/163 (36%)
Psmc1NP_476464.1 PTZ00361 1..440 CDD:185575 93/344 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.