DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and Psmb1

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_446042.1 Gene:Psmb1 / 94198 RGDID:621092 Length:240 Species:Rattus norvegicus


Alignment Length:248 Identity:55/248 - (22%)
Similarity:91/248 - (36%) Gaps:50/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VWSPQGRLHQVE-----YAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSDTQR---KIIPIDD 68
            |..|||....|:     ||..    |...:.:..:|::::.:..:.:...|...|   |...:.|
  Rat    15 VMGPQGSAGPVQMRFSPYAFN----GGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTD 75

  Fly    69 HLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTT--------TQRYDR 125
            ...|..:|...|...|::.:.:....||||              .||..||        |..|.|
  Rat    76 KTVIGCSGFHGDCLTLTKIIEARLKMYKHS--------------NNKAMTTGAIAAMLSTILYSR 126

  Fly   126 R--PYGVGLLVAGYDERGP-HIYQVTPSATFFNCKANSIGSRSQSARTYLE-----KNLN--KFL 180
            |  ||.|..::.|.||.|. .:|...|..::......:.||.|...:..|:     ||:.  :.:
  Rat   127 RFFPYYVYNIIEGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHV 191

  Fly   181 DSSKDEIIRHGIRAILGTLPTDEQGKDAGQYDITVAIVGKD--QPFTILSNKD 231
            ..:.|..:|......:.....|....||    :.:.||.|:  :..|:...||
  Rat   192 PLTLDRAMRLVKDVFISAAERDVYTGDA----LRICIVTKEGIREETVPLRKD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 53/246 (22%)
proteasome_alpha_type_1 6..219 CDD:239718 50/232 (22%)
Psmb1NP_446042.1 proteasome_beta_type_1 29..240 CDD:239726 48/232 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.