DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and PRE2

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_015428.1 Gene:PRE2 / 856218 SGDID:S000006307 Length:287 Species:Saccharomyces cerevisiae


Alignment Length:192 Identity:47/192 - (24%)
Similarity:78/192 - (40%) Gaps:19/192 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GTATVGLKNKDYAVLVALCKPTS---ELSDTQRKIIPIDDHLGISIAGLTADARVLSRYLRSEC- 92
            ||.|:..:.:...::....:.|:   ..|.|.:|:|.|:..|..::||..||.:....:|.|:| 
Yeast    75 GTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCR 139

  Fly    93 ---LNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVGLLVAGYDER-GPHIYQVTPSATF 153
               |..|...... ..|::::||       ..:|......:|.::.||..: ||.||.|....|.
Yeast   140 LHELREKERISVA-AASKILSNL-------VYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTR 196

  Fly   154 FNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAILGTLPTDE-QGKDAGQYDIT 214
            .......:||....|...|:.|..  .|.|.::.:..|.|:||.....|. .|.....|.:|
Yeast   197 LKGDIFCVGSGQTFAYGVLDSNYK--WDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 47/192 (24%)
proteasome_alpha_type_1 6..219 CDD:239718 47/192 (24%)
PRE2NP_015428.1 proteasome_beta_type_5 76..264 CDD:239730 46/191 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.