DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and PRE9

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_011651.3 Gene:PRE9 / 853036 SGDID:S000003367 Length:258 Species:Saccharomyces cerevisiae


Alignment Length:269 Identity:88/269 - (32%)
Similarity:133/269 - (49%) Gaps:28/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSEL--SDTQ-RK 62
            |...:|||..|::||:|||:|||||:|::......:|:...|..||.|..|.||.|  .||. .|
Yeast     1 MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65

  Fly    63 IIPIDDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRP 127
            :..::|.:.:::|||||||.:|....|....||..:|:...||..|:..|.:..|..||....||
Yeast    66 LYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQGYTQHGGLRP 130

  Fly   128 YGVGLLVAGYDER-GPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHG 191
            :||..:.||||:| |..:|...||..:...||.|:|:.:.:|:|.|:      :|...|..:...
Yeast   131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------MDYKDDMKVDDA 189

  Fly   192 IRAILGTL--PTDEQGKDAGQYD-ITVAIVGK--------DQPFTILSNKDSAKHVAIAKENDND 245
            |...|.||  .||   ..|..|| :..|.:.|        .:.|.....||......|.|:::::
Yeast   190 IELALKTLSKTTD---SSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVKTGITKKDEDE 251

  Fly   246 TPRNDDDDD 254
                :.|:|
Yeast   252 ----EADED 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 81/241 (34%)
proteasome_alpha_type_1 6..219 CDD:239718 79/219 (36%)
PRE9NP_011651.3 proteasome_alpha_type_4 4..216 CDD:239721 79/220 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.