DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and SCL1

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_011504.3 Gene:SCL1 / 852873 SGDID:S000002979 Length:252 Species:Saccharomyces cerevisiae


Alignment Length:246 Identity:71/246 - (28%)
Similarity:120/246 - (48%) Gaps:14/246 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDSDVTVWSPQGRLHQVEYAMEAV-KLGTATVGLKNKDYAVLVALCKPTSELSD--TQRKIIPID 67
            ||..:|::||:|||:|||||.:|. :....::.::.||..|:::..|...:|.|  |...|..|.
Yeast    12 YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVSYIFCIS 76

  Fly    68 DHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVGL 132
            ..:|:.:.|...|||..:...::|...:::.|....|...|...:.|..|..|||...||.||.|
Yeast    77 RTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVIL 141

  Fly   133 LVAGYDER-GPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNK-----FLDSSKDEIIRHG 191
            .....||. ||.||:..|:..:...||.:.|.:.|...|.||.:..|     ..:.|.::::...
Yeast   142 TFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSKIDHINEESWEKVVEFA 206

  Fly   192 IRAILGTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKDSAKHVAIAKEN 242
            |..::     |..|.:..:.|:.|.:..||:.||:.:.....:.||||:::
Yeast   207 ITHMI-----DALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIAEQD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 67/233 (29%)
proteasome_alpha_type_1 6..219 CDD:239718 63/221 (29%)
SCL1NP_011504.3 proteasome_alpha_type_6 12..228 CDD:239723 63/220 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.