DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and PRE7

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_009512.1 Gene:PRE7 / 852239 SGDID:S000000137 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:42/203 - (20%)
Similarity:80/203 - (39%) Gaps:44/203 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EYAMEAVKL------------GTATVGLKNKDYAVLVALCKPTSELSDTQR---KIIPIDDHLGI 72
            ||:.||...            |...:|:..:|:|||....:..::.|...|   |:....|::.:
Yeast     7 EYSSEASNTPIEHQFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVM 71

  Fly    73 SIAGLTADARVLSRYLRSECLNYKHSY-DTTYPVSRLITNLGNKMQTTTQRYDRR--PYGVGLLV 134
            |..|..||...|.:..::....|...: |....::....|:.:.:      |.:|  ||.|..::
Yeast    72 SANGFAADGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLL------YGKRFFPYYVHTII 130

  Fly   135 AGYDERGP-HIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLN-----------------KFLD 181
            ||.||.|. .:|...|..::...:..:.|:.:.....:|:..:|                 |:| 
Yeast   131 AGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYL- 194

  Fly   182 SSKDEIIR 189
             |.:|:|:
Yeast   195 -SVEEVIK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 42/203 (21%)
proteasome_alpha_type_1 6..219 CDD:239718 42/203 (21%)
PRE7NP_009512.1 proteasome_beta_type_1 21..241 CDD:239726 38/189 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.