DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and AT1G79210

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001077845.1 Gene:AT1G79210 / 844262 AraportID:AT1G79210 Length:235 Species:Arabidopsis thaliana


Alignment Length:236 Identity:81/236 - (34%)
Similarity:132/236 - (55%) Gaps:9/236 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NQYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSD--TQRKIIPI 66
            :||...:|.:||.|:|.|:|:|:.||..|..::|:|..:..|:....|..|.|.|  :.:||..:
plant     4 SQYSFSLTTFSPSGKLVQIEHALTAVGSGQTSLGIKASNGVVIATEKKLPSILVDEASVQKIQHL 68

  Fly    67 DDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVG 131
            ..::|...:|:..|.|||.|..|.:...|...|....||::|:......||..||....||:||.
plant    69 TPNIGTVYSGMGPDFRVLVRKSRKQAEQYLRLYKEPIPVTQLVRETATVMQEFTQSGGVRPFGVS 133

  Fly   132 LLVAGYDERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAIL 196
            |||||||::||.:|||.||.::|:.||:::|....:|:|:|||...:  |...|:.|.   .|||
plant   134 LLVAGYDDKGPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYTE--DMELDDAIH---TAIL 193

  Fly   197 GTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKDSAKHVA 237
             ||....:|:.:.: :|.:..:|.|:.|.:|:..:...::|
plant   194 -TLKEGFEGEISSK-NIEIGKIGTDKVFRVLTPAEIDDYLA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 80/228 (35%)
proteasome_alpha_type_1 6..219 CDD:239718 75/214 (35%)
AT1G79210NP_001077845.1 proteasome_alpha_type_2 6..232 CDD:239719 79/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.