DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and PAF2

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_175158.1 Gene:PAF2 / 841128 AraportID:AT1G47250 Length:277 Species:Arabidopsis thaliana


Alignment Length:266 Identity:130/266 - (48%)
Similarity:175/266 - (65%) Gaps:10/266 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRNQYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSDTQRKIIP 65
            |||||||:|||.|||.|||.||||||||||.|:|.:||:::.:.||..:.|..||||..||||..
plant     1 MFRNQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQRKIFK 65

  Fly    66 IDDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGV 130
            :|||:|::|||||||.||||||:|||.:|:..:|::..||.||:.:|.:|.|..|||..:|||||
plant    66 VDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCTQRSWKRPYGV 130

  Fly   131 GLLVAGYDERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAI 195
            ||||.|.||.|.|:|...||..:|..:|.:||||||:|:||||:....|.:|||:::|:..|.||
plant   131 GLLVGGLDESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFESFQESSKEDLIKDAIMAI 195

  Fly   196 LGTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKDSAKHVAIAKENDNDTPRNDDDDDRPSPPE 260
            ..||    ||:.......||:::|.|:||..|..:      :|.|..|......::::|......
plant   196 RETL----QGETLKSSLCTVSVLGVDEPFHFLDQE------SIQKVIDTFEKVPEEEEDAGEGEA 250

  Fly   261 EPAAGP 266
            ||.|.|
plant   251 EPEAAP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 119/226 (53%)
proteasome_alpha_type_1 6..219 CDD:239718 112/212 (53%)
PAF2NP_175158.1 proteasome_alpha_type_1 6..215 CDD:239718 112/212 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 183 1.000 Domainoid score I1012
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I1037
OMA 1 1.010 - - QHG53705
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0003679
OrthoInspector 1 1.000 - - mtm980
orthoMCL 1 0.900 - - OOG6_102143
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2552
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.