DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and PAD2

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_201415.1 Gene:PAD2 / 836746 AraportID:AT5G66140 Length:250 Species:Arabidopsis thaliana


Alignment Length:261 Identity:93/261 - (35%)
Similarity:145/261 - (55%) Gaps:18/261 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSDTQ--RKIIPID 67
            :||..:||:||.|.|.|||||:|||:.|.|.||::..|..||....|.|.:|.|::  |||:.:|
plant     3 RYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSRSARKIVSLD 67

  Fly    68 DHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVGL 132
            :|:.::.|||.||||||....|.||.:::.:.:....|..:...:....|..||....||:|:..
plant    68 NHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLST 132

  Fly   133 LVAGYD--ERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAI 195
            |:.|:|  .|.|.:||..||.||...|||:.|..|.|.|.:||||   :.:||..|.|:..|||:
plant   133 LIVGFDPYSRLPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKN---YKESSGQETIKLAIRAL 194

  Fly   196 LGTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKDSAKHVAIAKENDNDTPRNDDDDDRPSPPE 260
            |..:       ::|..:|.||::.:::  |.|...:.|:..||..:.:.:  :...:..:..||:
plant   195 LEVV-------ESGGKNIEVAVMTREE--TGLRQLEEAEIDAIVAKIEAE--KAAAEAAKKGPPK 248

  Fly   261 E 261
            |
plant   249 E 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 87/229 (38%)
proteasome_alpha_type_1 6..219 CDD:239718 85/216 (39%)
PAD2NP_201415.1 PRK03996 1..229 CDD:235192 89/237 (38%)
proteasome_alpha_type_7 4..210 CDD:239724 85/215 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.