DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and PAC1

DIOPT Version :10

Sequence 1:NP_523532.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_188850.1 Gene:PAC1 / 821774 AraportID:AT3G22110 Length:250 Species:Arabidopsis thaliana


Alignment Length:199 Identity:68/199 - (34%)
Similarity:117/199 - (58%) Gaps:6/199 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSEL---SDTQRKIIPI 66
            :|||..|::||:|||:||||||||:....:.:|:.:||..||:...|.||:|   |.:..|:..|
plant     4 RYDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILSKDGVVLIGEKKVTSKLLQTSTSAEKMYKI 68

  Fly    67 DDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVG 131
            |||:..::||:.:||.:|....|.:...|...|....||.:|:.:|.:..|..||....||:||.
plant    69 DDHVACAVAGIMSDANILINTARVQAQRYTFMYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVS 133

  Fly   132 LLVAGYDE-RGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAI 195
            .|.||:|: .|..:|...||..:...||.::|:.:|:|::.|:::...  |::::|.:...::.:
plant   134 FLFAGWDKHHGFQLYMSDPSGNYGGWKAAAVGANNQAAQSILKQDYKD--DATREEAVELALKVL 196

  Fly   196 LGTL 199
            ..|:
plant   197 TKTM 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_523532.1 proteasome_alpha_type_1 6..219 CDD:239718 68/198 (34%)
PAC1NP_188850.1 proteasome_alpha_type_4 3..215 CDD:239721 68/199 (34%)

Return to query results.
Submit another query.