DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and PAG1

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001323455.1 Gene:PAG1 / 817244 AraportID:AT2G27020 Length:351 Species:Arabidopsis thaliana


Alignment Length:250 Identity:74/250 - (29%)
Similarity:126/250 - (50%) Gaps:18/250 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVL--VALCKPTSELSDTQRKIIPIDD 68
            ||..||.:||.||:.|:|||.:||......||:|.||..|:  ..|......|..:.|:|..:..
plant   110 YDLSVTTFSPDGRVFQIEYAAKAVDNSGTVVGIKCKDGIVMGVEKLIASKMMLPGSNRRIHSVHR 174

  Fly    69 HLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVGLL 133
            |.|:::|||.||.|.:....:||..:|:..|....||..|...:.:.:...|..:..||:|.|::
plant   175 HAGMAVAGLAADGRQIVARAKSEARSYESVYGDAVPVKELSERVASYVHLCTLYWWLRPFGCGVI 239

  Fly   134 VAGYDERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEK-NLNKFLDSSKDEIIRHGIRAILG 197
            :.|||..||.:|.:.||...:.....:||...|:|:|.:|| ||::.  :.|:.:|.  :..|:.
plant   240 LGGYDRDGPQLYMIEPSGISYRYFGAAIGKGKQAAKTEIEKLNLSEM--TCKEGVIE--VAKIIY 300

  Fly   198 TLPTDEQGKDAGQYDITVAIVGKDQ-------PFTILSNKDSAKHVAIAKENDND 245
            .|  .::.||.. :::.::.:.::.       |..:|....:|...|: :|.|.|
plant   301 KL--HDEAKDKA-FELEMSWICEESKREHQKVPDDLLEEAKTAAKTAL-EEMDAD 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 69/234 (29%)
proteasome_alpha_type_1 6..219 CDD:239718 67/215 (31%)
PAG1NP_001323455.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.