DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and Psmb11

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_780413.1 Gene:Psmb11 / 73902 MGIID:1921152 Length:302 Species:Mus musculus


Alignment Length:181 Identity:44/181 - (24%)
Similarity:71/181 - (39%) Gaps:36/181 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 WS-PQGRLHQVEYAMEAVKL--GTATVGLKNKDYAVLVALCKPTSELSDTQ------------RK 62
            |: |:|...|....:...:|  ||.|:..:.: :.|:.|        :||:            ||
Mouse    27 WAVPRGCDPQTFLQIHGPRLAHGTTTLAFRFR-HGVIAA--------ADTRSSCGSYVACPASRK 82

  Fly    63 IIPIDDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRP 127
            :||:...|..:.:|.:||.....|.||.| |..:...:...|.......|...|.:..:      
Mouse    83 VIPVHQRLLGTTSGTSADCATWYRVLRRE-LRLRELREGQLPSVAGTAKLLAAMMSCYR------ 140

  Fly   128 YGVGLLVA----GYDERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEK 174
             |:.|.||    |:|..||.::.|....|.......|:||.|..|...|::
Mouse   141 -GLDLCVATALCGWDHSGPALFYVYSDGTCLQGDIFSVGSGSPYAYGVLDR 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 44/181 (24%)
proteasome_alpha_type_1 6..219 CDD:239718 44/181 (24%)
Psmb11NP_780413.1 20S_bact_beta 48..253 CDD:163402 39/160 (24%)
proteasome_beta_type_5 50..237 CDD:239730 38/158 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.