DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and PSMB10

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_002792.1 Gene:PSMB10 / 5699 HGNCID:9538 Length:273 Species:Homo sapiens


Alignment Length:233 Identity:59/233 - (25%)
Similarity:97/233 - (41%) Gaps:41/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AVKLGTATVGLKNKDYAVLVALCKPTSE--LSDTQ-RKIIPIDDHLGISIAGLTADARVLSRYLR 89
            |.|.||...||..:|..:|.|..:.|::  ::|.. .||..|...:....||:.|||.:.:|.:.
Human    35 ARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVA 99

  Fly    90 SECLNYKHSYDT-TYPVSRLITNLGNKMQTTTQRYDRRPYGVGLLVAGYDERGPHIYQVTPSATF 153
            |:.  ..|:..| ..|....:|.:   ::.|..||... .|..|:|.|.|..||.:|.|.|..::
Human   100 SKM--ELHALSTGREPRVATVTRI---LRQTLFRYQGH-VGASLIVGGVDLTGPQLYGVHPHGSY 158

  Fly   154 FNCKANSIGSRSQSARTYLEKNL--NKFLDSSKDEIIRHGIRAILGTL----------------- 199
            ......::||...:|...||...  |..|::::..::......|||.|                 
Human   159 SRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAK 223

  Fly   200 -------PTDEQGKDAGQYDI---TVAIVGKD-QPFTI 226
                   || |..|.:|:|..   |.|::.:. :|.|:
Human   224 LLRTLSSPT-EPVKRSGRYHFVPGTTAVLTQTVKPLTL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 59/233 (25%)
proteasome_alpha_type_1 6..219 CDD:239718 57/223 (26%)
PSMB10NP_002792.1 proteasome_beta_type_7 40..227 CDD:239732 46/192 (24%)
Pr_beta_C 232..267 CDD:403609 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.