DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and PSMB7

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_002790.1 Gene:PSMB7 / 5695 HGNCID:9544 Length:277 Species:Homo sapiens


Alignment Length:249 Identity:57/249 - (22%)
Similarity:110/249 - (44%) Gaps:42/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VTVWSP-----------QGRLHQVEYAMEAVKL------GTATVGLKNKDYAVLVALCKPTSELS 57
            |:|::|           :..:.:.::|....||      ||...|:..||..||.|..:.|..:.
Human     4 VSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMV 68

  Fly    58 DTQR---KIIPIDDHLGISIAGLTADARVLSRYLRSECLNYK-HSYDTTYPVSRLITNLGNKM-Q 117
            ...:   ||..|..::....||..||..:.::.:.|   |.: ||. :|..:.|::|  .|:| :
Human    69 VADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISS---NLELHSL-STGRLPRVVT--ANRMLK 127

  Fly   118 TTTQRYDRRPY-GVGLLVAGYDERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLD 181
            ....||  :.| |..|::.|.|..|||:|.:.|..:.......::||.|.:|....|   :||..
Human   128 QMLFRY--QGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFE---DKFRP 187

  Fly   182 SSKDEIIRHGIRAILGTLPTDEQGKDAGQYDITVAIVGKD-----QPFTILSNK 230
            ..::|..::.:...:.....::.|..:   :|.:.::.|:     :|:|:.:.|
Human   188 DMEEEEAKNLVSEAIAAGIFNDLGSGS---NIDLCVISKNKLDFLRPYTVPNKK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 57/249 (23%)
proteasome_alpha_type_1 6..219 CDD:239718 53/231 (23%)
PSMB7NP_002790.1 proteasome_beta_type_7 44..232 CDD:239732 47/201 (23%)
Pr_beta_C 236..271 CDD:403609 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.