DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and PSMA6

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_002782.1 Gene:PSMA6 / 5687 HGNCID:9535 Length:246 Species:Homo sapiens


Alignment Length:243 Identity:74/243 - (30%)
Similarity:125/243 - (51%) Gaps:10/243 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDSDVTVWSPQGRLHQVEYAMEAVKLGTAT-VGLKNKDYAVLVALCKPTSEL--SDTQRKIIPID 67
            :|..:|::||:|||:|||||.:|:..|..| |.::.||.||:|...|...:|  |.|...:..|.
Human     9 FDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKIT 73

  Fly    68 DHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVGL 132
            :::|..:.|:|||:|...:..|.|..|:|:.|....||..|...:.:..|..||..:.||.|..:
Human    74 ENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCM 138

  Fly   133 LVAGYD-ERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAIL 196
            ::.|.| |:||.:|:..|:..:...||.:.|.:...:.::|||.:.|..|.:.::.:...|..:.
Human   139 ILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLS 203

  Fly   197 GTLPTDEQGKDAGQYDITVAIVGKDQP-FTILSNKDSAKHVAIAKEND 243
            ..|..|.:..     :|.|.:|..:.| |.||:..:...|:....|.|
Human   204 TVLSIDFKPS-----EIEVGVVTVENPKFRILTEAEIDAHLVALAERD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 71/229 (31%)
proteasome_alpha_type_1 6..219 CDD:239718 66/216 (31%)
PSMA6NP_002782.1 proteasome_alpha_type_6 8..220 CDD:239723 66/215 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.