DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and PSMA4

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001096137.1 Gene:PSMA4 / 5685 HGNCID:9533 Length:261 Species:Homo sapiens


Alignment Length:269 Identity:85/269 - (31%)
Similarity:124/269 - (46%) Gaps:34/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSDT---QRKIIPI 66
            :|||..|::||:|||:||||||||:......:|:...|..:|.|..:...:|.|.   ..||..:
Human     4 RYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKL 68

  Fly    67 DDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVG 131
            ::.:..|:||:|:||.||:..||.....|...|....|..:|:|.|.:..|..||...:||:||.
Human    69 NEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVS 133

  Fly   132 LLVAGYDER-GPHIYQVTPSATFFNCKANSIGSRSQSARTYLE------------------KNLN 177
            ||..|:|:. |..:||..||..:...||..||:.|.:|.:.|:                  |.||
Human   134 LLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLN 198

  Fly   178 KFLDSSKDEIIRHGIRAILGTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKDSAKHVAIAKEN 242
            |.:|.||    ....:..:.|| |.|.||       ||..|.|.:....|..|...:.....:|.
Human   199 KTMDVSK----LSAEKVEIATL-TRENGK-------TVIRVLKQKEVEQLIKKHEEEEAKAEREK 251

  Fly   243 DNDTPRNDD 251
            .....:..|
Human   252 KEKEQKEKD 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 82/247 (33%)
proteasome_alpha_type_1 6..219 CDD:239718 79/234 (34%)
PSMA4NP_001096137.1 proteasome_alpha_type_4 3..216 CDD:239721 71/215 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261 2/21 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.