DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and psma3

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001025358.1 Gene:psma3 / 564370 ZFINID:ZDB-GENE-050913-120 Length:255 Species:Danio rerio


Alignment Length:261 Identity:76/261 - (29%)
Similarity:127/261 - (48%) Gaps:29/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVL----VALCKPTSELSDTQRKIIPI 66
            ||...:.:||.||:.||||||:||:..:..:|::.||..|.    :.|.|...|.|:  ::|..|
Zfish     8 YDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSN--KRIFNI 70

  Fly    67 DDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVG 131
            |.|:|:::|||.||||.||...|.|..:::.:|....|:..|...:...:...|.....||:|..
Zfish    71 DRHVGMAVAGLLADARSLSEVAREEASSFRSNYGHDIPLKHLADRVAMYVHAYTLYSAVRPFGCS 135

  Fly   132 LLVAGYDE-RGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAI 195
            .::..||| .||.:|.|.||...:.....:||...|:|:|.:||...|  |.:..|:::...:.|
Zfish   136 FILGSYDEDDGPQLYMVDPSGIAYGYWGCAIGKAKQAAKTEIEKLQMK--DMTCRELVKEVAKII 198

  Fly   196 LGTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKDSAKHVAIAKENDNDTPR-------NDDDD 253
            .  :..||. ||.. :::.::.||:         ....:|..:.|:...:..:       .:||.
Zfish   199 Y--IVHDEV-KDKA-FELELSWVGE---------VTKGRHELVPKDVKEEAEKYAKESLEEEDDS 250

  Fly   254 D 254
            |
Zfish   251 D 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 71/229 (31%)
proteasome_alpha_type_1 6..219 CDD:239718 69/217 (32%)
psma3NP_001025358.1 proteasome_alpha_type_3 5..217 CDD:239720 69/216 (32%)
PRE1 6..241 CDD:223711 73/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.