DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and psma3

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001011257.1 Gene:psma3 / 496707 XenbaseID:XB-GENE-976787 Length:255 Species:Xenopus tropicalis


Alignment Length:263 Identity:75/263 - (28%)
Similarity:129/263 - (49%) Gaps:31/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVL----VALCKPTSELSDTQRKIIPI 66
            ||...:.:||.||:.|||||.:||:..:..:|::.||..|.    :.|.|...|.|:  ::|..:
 Frog     8 YDLSASTFSPDGRVFQVEYAAKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSN--KRIFNV 70

  Fly    67 DDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVG 131
            |.|:|:::|||.||||.|:...|.|..|::.:|....|:..|...:...:...|.....||:|..
 Frog    71 DRHVGMAVAGLLADARSLADIAREEASNFRANYGYDIPLKHLSDRVAMYVHAYTLYSAVRPFGCS 135

  Fly   132 LLVAGYDE-RGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAI 195
            .::..|:| .|..:|.|.||...:.....:||...|:|:|.:||...|  |.:..::::...:.|
 Frog   136 FMLGSYNEDDGAQLYMVDPSGISYGYWGCAIGKAKQAAKTEIEKLQMK--DMTCRDVVKEVAKII 198

  Fly   196 LGTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKDSAKHVAIAKENDNDTPR---------NDD 251
            .  :..||. ||. .:::.::.|||      ::|   .||..:.|:...:..:         :|.
 Frog   199 Y--IVHDEV-KDK-SFELELSWVGK------ITN---GKHEIVPKDIREEAEKYAKESLEEEDDS 250

  Fly   252 DDD 254
            |||
 Frog   251 DDD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 68/229 (30%)
proteasome_alpha_type_1 6..219 CDD:239718 64/217 (29%)
psma3NP_001011257.1 proteasome_alpha_type_3 5..217 CDD:239720 64/216 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.