DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and Prosalpha1

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster


Alignment Length:243 Identity:77/243 - (31%)
Similarity:125/243 - (51%) Gaps:12/243 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDSDVTVWSPQGRLHQVEYAMEAV-KLGTATVGLKNKDYAVLVALCKPTSE--LSDTQRKIIPID 67
            :|..:|::||:|||:|||||.:|: :....||.||:.|.||:....|.|.:  :.:|...:..|.
  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRIT 73

  Fly    68 DHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVGL 132
            ..:|.::.|..||:|...:..|.|..|:::.|....||..|...:.:..|..||..:.||.|..:
  Fly    74 KDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSM 138

  Fly   133 LVAGYD-ERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAIL 196
            ::..|| |.||.:|:..|:..|...||.|:|:::..|.:||||.....|  |:::.|:..|..:.
  Fly   139 VLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNL--SEEKAIQLAISCLS 201

  Fly   197 GTLPTDEQGKDAGQYDITVAIVGKDQP-FTILSNKDSAKHVAIAKEND 243
            ..|..|  .|..|   |.:.:|.|..| |.||..::..:|:....|.|
  Fly   202 SVLAID--FKPNG---IEIGVVSKSDPTFRILDEREIEEHLTKIAEKD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 74/229 (32%)
proteasome_alpha_type_1 6..219 CDD:239718 68/216 (31%)
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 75/240 (31%)
proteasome_alpha_type_6 8..218 CDD:239723 68/215 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441034
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.