DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and Prosbeta5

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_652014.1 Gene:Prosbeta5 / 45269 FlyBaseID:FBgn0029134 Length:282 Species:Drosophila melanogaster


Alignment Length:238 Identity:63/238 - (26%)
Similarity:102/238 - (42%) Gaps:42/238 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SPQGRLHQVEYAME--AVKL----GTATVGLKNKDYAVLVALCKPTSEL---SDTQRKIIPIDDH 69
            :|...|:|::...:  .||:    ||.|:|.|.|...:|....:.|...   |.:.:||:.|:..
  Fly    49 NPLHNLNQIQANGDKTGVKINFDHGTTTLGFKFKGGVLLAVDSRATGGSYIGSQSMKKIVEINQF 113

  Fly    70 LGISIAGLTADA----RVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGV 130
            :..::||..||.    ||||:..|...|..|...... ..|:::.|:.::       |......:
  Fly   114 MLGTLAGGAADCVYWDRVLSKECRLHELRNKERISVA-AASKIMANIAHE-------YKGMGLSM 170

  Fly   131 GLLVAGYDERGPHIYQV------TPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIR 189
            |:::||||:|||.:|.|      ||...|      |:||.|..|...|:...:..|:..:.:.: 
  Fly   171 GMMLAGYDKRGPGLYYVDSEGSRTPGNLF------SVGSGSLYAYGVLDSGYHWDLEDKEAQEL- 228

  Fly   190 HGIRAIL-GTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKD 231
             |.|||. .|......|.....|.|      |:..:..:||.|
  Fly   229 -GRRAIYHATFRDAYSGGIIRVYHI------KEDGWVNISNTD 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 62/236 (26%)
proteasome_alpha_type_1 6..219 CDD:239718 59/224 (26%)
Prosbeta5NP_652014.1 PTZ00488 38..272 CDD:185666 63/238 (26%)
proteasome_beta_type_5 74..261 CDD:239730 54/208 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440947
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.