DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and psmb1

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001003889.1 Gene:psmb1 / 445413 ZFINID:ZDB-GENE-040618-2 Length:237 Species:Danio rerio


Alignment Length:219 Identity:49/219 - (22%)
Similarity:77/219 - (35%) Gaps:55/219 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GTATVGLKNKDYAVLVA---LCKPTSELSDTQRKIIPIDDHLGISIAGLTADARVLSRYLRSECL 93
            |...:.:..:|:|::.:   |.:..|..|....|...:.|...:..:|...|...|::.:.:...
Zfish    33 GGTVLAVAGEDFAIVASDTRLSEGYSIHSRDSPKCYKLTDTTVLGCSGFHGDCLTLTKIIEARLK 97

  Fly    94 NYKHSYDTTYPVSRLITNLGNKMQT--------TTQRYDRR--PYGVGLLVAGYDERG-PHIYQV 147
            .||||              .||..|        :|..|.||  ||.|..::.|.||.| ..:|..
Zfish    98 MYKHS--------------NNKSMTSGAIAAMLSTILYGRRFFPYYVYNIIGGLDEEGRGAVYSF 148

  Fly   148 TPSATFFNCKANSIGSRSQSARTYLE-----KNL----------NKFLDSSKDEIIRHGIRAILG 197
            .|..::......:.||.|...:..|:     ||:          .|.:...||..|....|    
Zfish   149 DPVGSYQRDTYKAGGSASAMLQPLLDNQIGFKNMENVEHVPLTQEKAVQLVKDVFISAAER---- 209

  Fly   198 TLPTDEQGKDAGQYDITVAIVGKD 221
                |....||    :.|.||.|:
Zfish   210 ----DVYTGDA----LKVCIVSKE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 49/219 (22%)
proteasome_alpha_type_1 6..219 CDD:239718 47/215 (22%)
psmb1NP_001003889.1 PRE1 22..237 CDD:223711 49/219 (22%)
proteasome_beta_type_1 26..237 CDD:239726 49/219 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.