DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and Prosalpha4T1

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster


Alignment Length:245 Identity:74/245 - (30%)
Similarity:123/245 - (50%) Gaps:13/245 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NQYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSD--TQRKIIPI 66
            ::|...:|::||.|.|.|||||.|||:.|:..||::..:..||.......||:.:  |.|||..:
  Fly     3 SRYGRALTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKISML 67

  Fly    67 DDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVG 131
            |.|:.::.||||||||:|....:.||.:::.:::....:..:...|....|..||...|||:|:.
  Fly    68 DRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFGIS 132

  Fly   132 LLVAGYDERG-PHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAI 195
            .|:.|.|..| ..::...||..|...||.:.|..:.:.|.:.||..:....::|.:.|:..:||:
  Fly   133 CLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMRAL 197

  Fly   196 LGTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKDSAKHVAIAKENDND 245
            |       :.....|..:.||::...:|..:|   ||.....|.|...|:
  Fly   198 L-------EVTQMSQMRLEVAVLENGKPMKML---DSVVISEIVKIVQNE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 69/229 (30%)
proteasome_alpha_type_1 6..219 CDD:239718 67/215 (31%)
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 74/243 (30%)
proteasome_alpha_type_7 5..213 CDD:239724 67/214 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441087
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.