DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and Prosbeta7

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_649529.1 Gene:Prosbeta7 / 40639 FlyBaseID:FBgn0250746 Length:268 Species:Drosophila melanogaster


Alignment Length:253 Identity:46/253 - (18%)
Similarity:92/253 - (36%) Gaps:56/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSDTQ--------- 60
            |...::|...|.|..|    :..:...||:.:|:: .|..|::|        :||.         
  Fly    34 QLPRELTTMGPYGTKH----STASSTTGTSVLGIR-YDSGVMLA--------ADTLVSYGSMARY 85

  Fly    61 ---RKIIPIDDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQT---- 118
               .::..::.::.:..:|..||.:.:.|.:..:.:..:...|          |:..|.::    
  Fly    86 QNIERVFKVNKNILLGGSGDFADIQSIKRNIDQKMIEDQCCDD----------NIEMKPKSLASW 140

  Fly   119 -TTQRYDRR----PYGVGLLVAGYDERG-PHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLN 177
             |...|:||    |..:.::|.|.|..| |::..|......:.....:.|.....|...:.:...
  Fly   141 MTRVLYNRRSRMNPLYIDVVVGGVDNEGTPYLANVDLRGRSYEDYVVATGFARHLAVPLVREKKP 205

  Fly   178 K---FLDSSKDEIIRHGIRAILGTLPTDEQGKDAGQYDITVAIV---GKDQPFTILSN 229
            |   |......|:||..:..:.     ....::..||.:.|..|   |.:.||.:..|
  Fly   206 KDRDFTAVEASELIRTCMEVLY-----YRDTRNISQYTVGVCSVNGCGVEGPFQVNEN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 46/253 (18%)
proteasome_alpha_type_1 6..219 CDD:239718 41/240 (17%)
Prosbeta7NP_649529.1 proteasome_beta_type_4 60..252 CDD:239729 36/215 (17%)
PRE1 60..232 CDD:223711 31/195 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441160
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.