DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and psma5

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_991271.1 Gene:psma5 / 403011 ZFINID:ZDB-GENE-040625-96 Length:241 Species:Danio rerio


Alignment Length:231 Identity:82/231 - (35%)
Similarity:127/231 - (54%) Gaps:22/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MF--RNQYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSDTQ--R 61
            ||  |::||..|..:||:|||.|||||:||:|||:..:|::..:...|....:.||.|.:..  .
Zfish     1 MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIE 65

  Fly    62 KIIPIDDHLGISIAGLTADARVLSRYLRSECLNYKHSYD---TTYPVSRLITNLGNKMQTTTQRY 123
            ||:.||.|:|.:::||.|||:.|....|.|..|:..:|:   |...|::.::||.  :|...:..
Zfish    66 KIVEIDSHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLA--LQFGEEDA 128

  Fly   124 D----RRPYGVGLLVAGYDERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFL---D 181
            |    .||:||.||..|.||:||.:|.:.||.||..|.|.:|||.|:.|::.|::..:|.:   |
Zfish   129 DPGAMSRPFGVALLFGGVDEKGPQLYHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKD 193

  Fly   182 SSKD------EIIRHGIRAILGTLPTDEQGKDAGQY 211
            :.|.      :::...:.|....|.|.|.||....|
Zfish   194 AIKSSLTILKQVMEEKLNATNIELATVEPGKTFHMY 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 79/226 (35%)
proteasome_alpha_type_1 6..219 CDD:239718 79/224 (35%)
psma5NP_991271.1 proteasome_alpha_type_5 8..220 CDD:239722 74/213 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.