DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and Prosbeta6

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster


Alignment Length:216 Identity:51/216 - (23%)
Similarity:90/216 - (41%) Gaps:47/216 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GTATVGLKNKDYAVLVALCKPTSEL---SDTQRKIIPIDDHLGISIAGLTADARVLSRYLRSECL 93
            |.:.|.:...|:||:.|..:.:|..   |.||.|:..:.....:..||..||...|:..::....
  Fly    29 GGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQ 93

  Fly    94 NYKHSY---DTTYPVSRLITNLGNKMQTTTQRYDRR--PYGVGLLVAGYDERGPH-IYQVTP--- 149
            :|:|::   .||..|::::         :...|:||  ||.|..::||.|..|.. :|...|   
  Fly    94 SYEHTHLRTMTTEAVAQML---------SIAMYNRRFFPYYVSNILAGIDNEGKGVVYSYDPIGH 149

  Fly   150 --SATFFNCKANSIGSRSQSARTYLE---------KNLNKFLDSSKDEIIRHGIRAILGTLPTDE 203
              .||:   :|..      :|.|.|:         ||:| ..|:.|.::.:.  ||:.....|..
  Fly   150 CEKATY---RAGG------TAGTLLQPVLDNQIGHKNMN-LEDADKIKLTKE--RAVSVASDTFI 202

  Fly   204 QGKDAGQY---DITVAIVGKD 221
            ...:...|   .:.:.|:.||
  Fly   203 SAAERDIYTGDSVLINIITKD 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 51/216 (24%)
proteasome_alpha_type_1 6..219 CDD:239718 49/212 (23%)
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 51/216 (24%)
PRE1 24..225 CDD:223711 51/216 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441170
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.