DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and psmb1

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_988993.1 Gene:psmb1 / 394589 XenbaseID:XB-GENE-970603 Length:239 Species:Xenopus tropicalis


Alignment Length:211 Identity:53/211 - (25%)
Similarity:76/211 - (36%) Gaps:39/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GTATVGLKNKDYAVLVA---LCKPTSELSDTQRKIIPIDDHLGISIAGLTADARVLSRYLRSECL 93
            |...:.|...|:|::.:   |.:..|..|....|...:.|:..|...|..||...|::.:.:...
 Frog    35 GGTVLALAGDDFALVASDTRLSEGYSIHSRNTPKCYKLTDNTVIGCTGFHADCLTLTKIIEARLK 99

  Fly    94 NYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRR--PYGVGLLVAGYDERGP-HIYQVTP------ 149
            .||||.:.|.....:...|      :|..|.||  ||.|..::.|.||.|. .:|...|      
 Frog   100 MYKHSNNKTMTSGAIAAML------STILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQR 158

  Fly   150 ---------SATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAILGTLPTDEQG 205
                     ||.......|.||.::......|...|.|.|...||..|....|        |...
 Frog   159 DAYKAGGSASAMLQPLLDNQIGYKNMQNVEQLPLTLEKALKLIKDVFISAAER--------DVYT 215

  Fly   206 KDAGQYDITVAIVGKD 221
            .||    :.::||.||
 Frog   216 GDA----LHISIVTKD 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 53/211 (25%)
proteasome_alpha_type_1 6..219 CDD:239718 50/207 (24%)
psmb1NP_988993.1 proteasome_beta_type_1 28..239 CDD:239726 53/211 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.