DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and Prosalpha3

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_476691.1 Gene:Prosalpha3 / 37378 FlyBaseID:FBgn0261394 Length:264 Species:Drosophila melanogaster


Alignment Length:240 Identity:80/240 - (33%)
Similarity:129/240 - (53%) Gaps:15/240 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSDT---QRKIIPI 66
            :|||..|::||:|||:||||||||:......:|:..:|..:|.|.|:.|::|.|:   ..||..:
  Fly     4 RYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILAEDGILLAAECRSTNKLLDSAIPSEKIYRL 68

  Fly    67 DDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVG 131
            :|::..|:||:|:||.||:..||.....|:.||....|..:|:::|.:..|..||...:||:||.
  Fly    69 NDNMVCSVAGITSDANVLTSELRLIAQRYQFSYGEVIPCEQLVSHLCDIKQAYTQYGGKRPFGVS 133

  Fly   132 LLVAGYDER-GPHIYQVTPSATFFNCKANSIGSRSQSARTYL------EKNLNKFLDSSKDEIIR 189
            ||..|:|.: |..:||..||..:...||..||:...:|.:.|      ::|:...|..:||..|:
  Fly   134 LLYMGWDNKYGYQLYQSDPSGNYGGWKATCIGNNFGAAISMLKQELADKENVKLTLADAKDLAIK 198

  Fly   190 HGIRAILGTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKDSAK 234
            .....:..|..|.|:.:.|     |:..|.....:::|...|..|
  Fly   199 VLSMTLDTTKLTPEKVEMA-----TLQRVDNKTVYSVLEKPDVEK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 78/235 (33%)
proteasome_alpha_type_1 6..219 CDD:239718 76/222 (34%)
Prosalpha3NP_476691.1 PTZ00246 1..245 CDD:173491 80/240 (33%)
proteasome_alpha_type_4 3..219 CDD:239721 75/219 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441157
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.