DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and Prosalpha7

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster


Alignment Length:262 Identity:70/262 - (26%)
Similarity:120/262 - (45%) Gaps:33/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSEL--SDTQRKIIPIDD 68
            ||...:.:||.||:.|::||.:||:.....:|::.||..||......||:|  .|...:|..|:.
  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIEK 72

  Fly    69 HLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVGLL 133
            ::|:::|||.||...::...|.|..||:..::...|:..|...:...:...|.....||:|:.::
  Fly    73 NIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSII 137

  Fly   134 VAGYDE-RGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAILG 197
            :|.:|| .||.:|::.||.:.|...|.:.|...|.|:|.:||             ::..:|    
  Fly   138 LASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEK-------------LKMDMR---- 185

  Fly   198 TLPTDEQGKDAGQ--YDITVAIVGKDQPFT--ILSNKDSAKHVAIAKE------NDNDTPRNDDD 252
               |||..:.||:  |.:...:..||..|.  ::.......|:....|      ...|....|:|
  Fly   186 ---TDELVESAGEIIYKVHDELKDKDFRFEMGLVGRVTGGLHLINPSELTEKARKAGDAANKDED 247

  Fly   253 DD 254
            .|
  Fly   248 SD 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 64/231 (28%)
proteasome_alpha_type_1 6..219 CDD:239718 61/217 (28%)
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 64/227 (28%)
PRE1 6..231 CDD:223711 65/242 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441008
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.