DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and Prosbeta4

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster


Alignment Length:217 Identity:51/217 - (23%)
Similarity:76/217 - (35%) Gaps:66/217 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VGLKNKDYAVLVA---LCKPTSELSDTQRKIIPIDDHLGISIAGLTADARVLSRYLRSECLNYK- 96
            :|:|..|:.:|.|   ..:....:.:.|.||..:.|.|.||..|.:.|....:.::......|| 
  Fly     5 LGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALYKM 69

  Fly    97 -HSYDTTYPVSRLIT--NLGNKMQTTTQRYDRRPYGVGLLVAGYD-ERGPHIYQVTPSATFFNCK 157
             :.||.:...|...|  ||...:::      |.||.|.:.||||| ..||.:       ||.:..
  Fly    70 RNGYDLSPRESAHFTRKNLAEYLRS------RTPYQVFMFVAGYDPNAGPEL-------TFIDYL 121

  Fly   158 ANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAILGTLPTDEQG----KDAGQYDI----- 213
            ||::......                      ||..||..:...|...    ..|..||:     
  Fly   122 ANALPVNYAG----------------------HGYGAIFASSIYDRYWHPNITQAEAYDVFKKCI 164

  Fly   214 --------------TVAIVGKD 221
                          |||:|.||
  Fly   165 AEIQKRLVVNLKNFTVAVVDKD 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 51/217 (24%)
proteasome_alpha_type_1 6..219 CDD:239718 48/213 (23%)
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 51/217 (24%)
proteasome_beta_type_2 1..192 CDD:239727 51/217 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441120
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.