DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and Prosbeta4R1

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_608698.2 Gene:Prosbeta4R1 / 33449 FlyBaseID:FBgn0031442 Length:215 Species:Drosophila melanogaster


Alignment Length:130 Identity:34/130 - (26%)
Similarity:54/130 - (41%) Gaps:20/130 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MEAVKLGTATVGLKNKDYAVLVA---LCKPTSELSDTQRKIIPIDDHLGISIAGLTADARVLSRY 87
            ||.:      :|:|..|:.:|.:   ..|....|.|..||...|.|:..:|.||...|....|.:
  Fly     1 METI------LGVKGTDFIILASDTMRNKSAMWLDDEVRKTHRISDYCMMSTAGDGGDCLKFSDF 59

  Fly    88 LRSECLNYK--HSYDTTY--PVSRLITNLGNKMQTTTQRYDRRPYGVGLLVAGYD-ERGPHIYQV 147
            :......||  :.||.|.  .|..:..:|...:::..      .:.|.|||.||| ..||.::.:
  Fly    60 ILRNMDLYKITNGYDLTVRGAVHFIRRHLSAYLKSDC------TFQVSLLVGGYDLTSGPELHYI 118

  Fly   148  147
              Fly   119  118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 34/130 (26%)
proteasome_alpha_type_1 6..219 CDD:239718 34/130 (26%)
Prosbeta4R1NP_608698.2 PRE1 1..204 CDD:223711 34/130 (26%)
proteasome_beta_type_2 1..193 CDD:239727 34/130 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441116
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.