DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and Psma6

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_058979.1 Gene:Psma6 / 29673 RGDID:61849 Length:246 Species:Rattus norvegicus


Alignment Length:243 Identity:74/243 - (30%)
Similarity:125/243 - (51%) Gaps:10/243 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDSDVTVWSPQGRLHQVEYAMEAVKLGTAT-VGLKNKDYAVLVALCKPTSEL--SDTQRKIIPID 67
            :|..:|::||:|||:|||||.:|:..|..| |.::.||.||:|...|...:|  |.|...:..|.
  Rat     9 FDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKIT 73

  Fly    68 DHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVGL 132
            :::|..:.|:|||:|...:..|.|..|:|:.|....||..|...:.:..|..||..:.||.|..:
  Rat    74 ENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCM 138

  Fly   133 LVAGYD-ERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAIL 196
            ::.|.| |:||.:|:..|:..:...||.:.|.:...:.::|||.:.|..|.:.::.:...|..:.
  Rat   139 ILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLS 203

  Fly   197 GTLPTDEQGKDAGQYDITVAIVGKDQP-FTILSNKDSAKHVAIAKEND 243
            ..|..|.:..     :|.|.:|..:.| |.||:..:...|:....|.|
  Rat   204 TVLSIDFKPS-----EIEVGVVTVENPKFRILTEAEIDAHLVALAERD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 71/229 (31%)
proteasome_alpha_type_1 6..219 CDD:239718 66/216 (31%)
Psma6NP_058979.1 proteasome_alpha_type_6 8..220 CDD:239723 66/215 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.