DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and Psma5

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_058978.2 Gene:Psma5 / 29672 RGDID:61848 Length:241 Species:Rattus norvegicus


Alignment Length:242 Identity:81/242 - (33%)
Similarity:133/242 - (54%) Gaps:20/242 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MF--RNQYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSDTQ--R 61
            ||  |::||..|..:||:|||.|||||:||:|||:..:|::..:...|....:.||.|.:..  .
  Rat     1 MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIE 65

  Fly    62 KIIPIDDHLGISIAGLTADARVLSRYLRSECLNYKHSYD---TTYPVSRLITNLGNKMQTTTQRY 123
            ||:.||.|:|.:::||.|||:.|....|.|..|:..:|:   |...|::.::||.  :|...:..
  Rat    66 KIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLA--LQFGEEDA 128

  Fly   124 D----RRPYGVGLLVAGYDERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSK 184
            |    .||:||.||..|.||:||.::.:.||.||..|.|.:|||.|:.|::.|::..:|.:    
  Rat   129 DPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSM---- 189

  Fly   185 DEIIRHGIRAILGTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKD 231
              .::..|::.|..|....:.| ....:|.:|.|...|.|.:.:.::
  Rat   190 --TLKEAIKSSLIILKQVMEEK-LNATNIELATVQPGQNFHMFTKEE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 78/235 (33%)
proteasome_alpha_type_1 6..219 CDD:239718 75/221 (34%)
Psma5NP_058978.2 proteasome_alpha_type_5 8..220 CDD:239722 75/220 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.