DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and Psma3

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_058976.1 Gene:Psma3 / 29670 RGDID:61844 Length:255 Species:Rattus norvegicus


Alignment Length:262 Identity:70/262 - (26%)
Similarity:127/262 - (48%) Gaps:29/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVL----VALCKPTSELSDTQRKIIPI 66
            ||...:.:||.||:.||||||:||:..:..:|::.||..|.    :.|.|...|.|:  :::..:
  Rat     8 YDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSN--KRLFNV 70

  Fly    67 DDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVG 131
            |.|:|:::|||.||||.|:...|.|..|::.::....|:..|...:...:...|.....||:|..
  Rat    71 DRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCS 135

  Fly   132 LLVAGYD-ERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAI 195
            .::..|. ..|..:|.:.||...:.....:||...|:|:|.:||...|  :.:..::::...:.|
  Rat   136 FMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMK--EMTCRDVVKEVAKII 198

  Fly   196 LGTLPTDEQGKDAGQYDITVA---------IVGKDQPFTILSNKDSAKHVAIAKENDNDTPRNDD 251
            .  :..||....|.:.:::..         ||.||      ..:::.|:   |||:..:...:||
  Rat   199 Y--IVHDEVKDKAFELELSWVGELTKGRHEIVPKD------VREEAEKY---AKESLKEEDESDD 252

  Fly   252 DD 253
            |:
  Rat   253 DN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 63/238 (26%)
proteasome_alpha_type_1 6..219 CDD:239718 60/226 (27%)
Psma3NP_058976.1 proteasome_alpha_type_3 5..217 CDD:239720 59/214 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.