Sequence 1: | NP_001285798.1 | Gene: | Prosalpha6 / 34359 | FlyBaseID: | FBgn0250843 | Length: | 279 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001020808.1 | Gene: | Psmb10 / 291983 | RGDID: | 1307428 | Length: | 273 | Species: | Rattus norvegicus |
Alignment Length: | 198 | Identity: | 52/198 - (26%) |
---|---|---|---|
Similarity: | 84/198 - (42%) | Gaps: | 18/198 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 AVKLGTATVGLKNKDYAVLVALCKPTSE--LSDTQ-RKIIPIDDHLGISIAGLTADARVLSRYLR 89
Fly 90 SECLNYKHSYDT-TYPVSRLITNLGNKMQTTTQRYDRRPYGVGLLVAGYDERGPHIYQVTPSATF 153
Fly 154 FNCKANSIGSRSQSARTYLEKNL--NKFLDSSKDEIIRHGIRAILGTLPTDEQGKDAGQYDITVA 216
Fly 217 IVG 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha6 | NP_001285798.1 | PRE1 | 4..231 | CDD:223711 | 52/198 (26%) |
proteasome_alpha_type_1 | 6..219 | CDD:239718 | 51/196 (26%) | ||
Psmb10 | NP_001020808.1 | proteasome_beta_type_7 | 40..226 | CDD:239732 | 49/193 (25%) |
Pr_beta_C | 233..267 | CDD:403609 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |