DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and Psmb10

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001020808.1 Gene:Psmb10 / 291983 RGDID:1307428 Length:273 Species:Rattus norvegicus


Alignment Length:198 Identity:52/198 - (26%)
Similarity:84/198 - (42%) Gaps:18/198 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AVKLGTATVGLKNKDYAVLVALCKPTSE--LSDTQ-RKIIPIDDHLGISIAGLTADARVLSRYLR 89
            |.|.||...||..:|..:|.|..:.|::  ::|.. .||..|...:....||:.||..:.:|...
  Rat    35 ARKTGTTIAGLVFRDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADTEMTTRMAA 99

  Fly    90 SECLNYKHSYDT-TYPVSRLITNLGNKMQTTTQRYDRRPYGVGLLVAGYDERGPHIYQVTPSATF 153
            |:.  ..|:..| ..|....:|.:   ::.|..||... .|..|:|.|.|..||.:|.|.|..::
  Rat   100 SKM--ELHALSTGREPRVATVTRI---LRQTLFRYQGH-VGASLIVGGVDLNGPQLYSVHPHGSY 158

  Fly   154 FNCKANSIGSRSQSARTYLEKNL--NKFLDSSKDEIIRHGIRAILGTLPTDEQGKDAGQYDITVA 216
            ......::||...:|...||...  |..|:::::.::......|||.|.:      .|..|..|.
  Rat   159 SRLPFTALGSGQDAAVALLEDRFQPNMTLEAAQELLVEAITAGILGDLGS------GGSVDACVI 217

  Fly   217 IVG 219
            ..|
  Rat   218 TAG 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 52/198 (26%)
proteasome_alpha_type_1 6..219 CDD:239718 51/196 (26%)
Psmb10NP_001020808.1 proteasome_beta_type_7 40..226 CDD:239732 49/193 (25%)
Pr_beta_C 233..267 CDD:403609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.