DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and CG30382

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster


Alignment Length:243 Identity:77/243 - (31%)
Similarity:125/243 - (51%) Gaps:12/243 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YDSDVTVWSPQGRLHQVEYAMEAV-KLGTATVGLKNKDYAVLVALCKPTSE--LSDTQRKIIPID 67
            :|..:|::||:|||:|||||.:|: :....||.||:.|.||:....|.|.:  :.:|...:..|.
  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRIT 73

  Fly    68 DHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVGL 132
            ..:|.::.|..||:|...:..|.|..|:::.|....||..|...:.:..|..||..:.||.|..:
  Fly    74 KDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSM 138

  Fly   133 LVAGYD-ERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAIL 196
            ::..|| |.||.:|:..|:..|...||.|:|:::..|.:||||.....|  |:::.|:..|..:.
  Fly   139 VLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNL--SEEKAIQLAISCLS 201

  Fly   197 GTLPTDEQGKDAGQYDITVAIVGKDQP-FTILSNKDSAKHVAIAKEND 243
            ..|..|  .|..|   |.:.:|.|..| |.||..::..:|:....|.|
  Fly   202 SVLAID--FKPNG---IEIGVVSKSDPTFRILDEREIEEHLTKIAEKD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 74/229 (32%)
proteasome_alpha_type_1 6..219 CDD:239718 68/216 (31%)
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 75/240 (31%)
proteasome_alpha_type_6 8..218 CDD:239723 68/215 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441036
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.