DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and Psmb7

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_035317.1 Gene:Psmb7 / 19177 MGIID:107637 Length:277 Species:Mus musculus


Alignment Length:232 Identity:58/232 - (25%)
Similarity:99/232 - (42%) Gaps:41/232 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QVEYAMEAVKL------GTATVGLKNKDYAVLVALCKPTSELSDTQR---KIIPIDDHLGISIAG 76
            :.::|.:..||      ||...|:..||..||.|..:.|..:....:   ||..|..::....||
Mouse    26 EADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAG 90

  Fly    77 LTADARVLSRYLRSECLNYK-HSYDTTYPVSRLITNLGNKM-QTTTQRYDRRPY-GVGLLVAGYD 138
            ..||..:.::.:.|   |.: ||. ||..:.|::|  .|:| :....||  :.| |..|::.|.|
Mouse    91 TAADTDMTTQLISS---NLELHSL-TTGRLPRVVT--ANRMLKQMLFRY--QGYIGAALVLGGVD 147

  Fly   139 ERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSK-----DEIIRHGIRAILGT 198
            ..|||:|.:.|..:.......::||.|.:|....|......::..:     .|.|..||...|| 
Mouse   148 VTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIAAGIFNDLG- 211

  Fly   199 LPTDEQGKDAGQYDITVAIVGKD-----QPFTILSNK 230
                     :|. :|.:.::.|.     :||::.:.|
Mouse   212 ---------SGS-NIDLCVISKSKLDFLRPFSVPNKK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 58/232 (25%)
proteasome_alpha_type_1 6..219 CDD:239718 54/214 (25%)
Psmb7NP_035317.1 PRE1 41..225 CDD:223711 52/202 (26%)
proteasome_beta_type_7 44..232 CDD:239732 51/206 (25%)
Pr_beta_C 236..271 CDD:289249 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.