Sequence 1: | NP_001285798.1 | Gene: | Prosalpha6 / 34359 | FlyBaseID: | FBgn0250843 | Length: | 279 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_494913.1 | Gene: | pbs-3 / 173858 | WormBaseID: | WBGene00003949 | Length: | 204 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 49/199 - (24%) |
---|---|---|---|
Similarity: | 76/199 - (38%) | Gaps: | 51/199 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 DYAVLVA----LCKPTSELSDTQRKIIPIDDHLGISIAGLTADAR-VLSR-------YLRSECLN 94
Fly 95 YKHSYDTTYPVSRLITNLGNKMQTTTQRYDRR--PYGVGLLVAGYDERG-PHIYQVTPSATFFNC 156
Fly 157 KANSIGSRSQ--------SARTYLEKNLNKFL--DSSKDEIIRHGIRAILGTLPTD-EQGKDAGQ 210
Fly 211 YDIT 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha6 | NP_001285798.1 | PRE1 | 4..231 | CDD:223711 | 49/199 (25%) |
proteasome_alpha_type_1 | 6..219 | CDD:239718 | 49/199 (25%) | ||
pbs-3 | NP_494913.1 | PRE1 | 3..193 | CDD:223711 | 49/199 (25%) |
proteasome_beta_type_3 | 6..200 | CDD:239728 | 49/199 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |