DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and pbs-3

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_494913.1 Gene:pbs-3 / 173858 WormBaseID:WBGene00003949 Length:204 Species:Caenorhabditis elegans


Alignment Length:199 Identity:49/199 - (24%)
Similarity:76/199 - (38%) Gaps:51/199 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DYAVLVA----LCKPTSELSDTQRKIIPIDDHLGISIAGLTADAR-VLSR-------YLRSECLN 94
            |..|.:|    :.:..:.::..|:|:..:.|.:.:.:||..:||| ||.:       |...|..|
 Worm    17 DECVCIASDLRIGEQMTTIATDQKKVHKVTDKVYVGLAGFQSDARTVLEKIMFRKNLYELRENRN 81

  Fly    95 YKHSYDTTYPVSRLITNLGNKMQTTTQRYDRR--PYGVGLLVAGYDERG-PHIYQVTPSATFFNC 156
            .|...     :|.:|:||.         |..|  .|....||||.|:.. |:|           |
 Worm    82 IKPQV-----LSEMISNLA---------YQHRFGSYFTEPLVAGLDDTNKPYI-----------C 121

  Fly   157 KANSIGSRSQ--------SARTYLEKNLNKFL--DSSKDEIIRHGIRAILGTLPTD-EQGKDAGQ 210
            ..::||..|.        :.:.||......|.  :...||:.....::||..|..| ..|..|..
 Worm   122 CMDTIGCVSAPRDFVAVGTGQEYLLGVCENFWRENMKPDELFEATAQSILSCLERDAASGWGAVV 186

  Fly   211 YDIT 214
            |.||
 Worm   187 YTIT 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 49/199 (25%)
proteasome_alpha_type_1 6..219 CDD:239718 49/199 (25%)
pbs-3NP_494913.1 PRE1 3..193 CDD:223711 49/199 (25%)
proteasome_beta_type_3 6..200 CDD:239728 49/199 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.