Sequence 1: | NP_001285798.1 | Gene: | Prosalpha6 / 34359 | FlyBaseID: | FBgn0250843 | Length: | 279 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_493271.1 | Gene: | pbs-2 / 173168 | WormBaseID: | WBGene00003948 | Length: | 277 | Species: | Caenorhabditis elegans |
Alignment Length: | 202 | Identity: | 54/202 - (26%) |
---|---|---|---|
Similarity: | 87/202 - (43%) | Gaps: | 24/202 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 AMEAVKLGTATVGLKNKDYAVLVALCKPTSE--LSDTQ-RKIIPIDDHLGISIAGLTAD----AR 82
Fly 83 VLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPY-GVGLLVAGYDERGPHIYQ 146
Fly 147 VTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAILGTLPTDEQGKDAGQY 211
Fly 212 DITVAIV 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha6 | NP_001285798.1 | PRE1 | 4..231 | CDD:223711 | 54/202 (27%) |
proteasome_alpha_type_1 | 6..219 | CDD:239718 | 54/202 (27%) | ||
pbs-2 | NP_493271.1 | PRE1 | 43..228 | CDD:223711 | 53/198 (27%) |
proteasome_beta_type_7 | 47..235 | CDD:239732 | 52/194 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |