DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and pas-3

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001379751.1 Gene:pas-3 / 172139 WormBaseID:WBGene00003924 Length:250 Species:Caenorhabditis elegans


Alignment Length:243 Identity:79/243 - (32%)
Similarity:134/243 - (55%) Gaps:12/243 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSDTQ---RKIIPI 66
            :|||..|::||:|||:||||||||:......:|:.:.:..|:.|..|...:|.|..   .|:..:
 Worm     4 RYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILSSEGIVVAAERKNVHKLLDDSVMTEKVYRL 68

  Fly    67 DDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVG 131
            .|::..::||:||||.:|..:||....:|::||....||.:|:.||.|:.|..||...:||:||.
 Worm    69 SDNISCTVAGITADANILINHLRWWAASYRNSYGEEMPVEQLVQNLCNEKQRYTQIGGKRPFGVS 133

  Fly   132 LLVAGYDER-GPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGIRAI 195
            ||..|:|:. |..:||..||..:...||..|||..|:|.|.|::   ::...:.:|..:..|:.:
 Worm   134 LLYIGWDKHYGYQLYQSDPSGNYTGWKATCIGSNHQAAVTLLKQ---EYKSPNLEEAKQLAIKVL 195

  Fly   196 LGTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKDSAKHVAIAKEND 243
            ..||..    |.|.: .:.:|::.:....|:|....:.:..|:..|::
 Worm   196 WKTLDV----KLASE-KVEMAVLTRRDGKTVLEELTTKEVDALIAEHE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 77/229 (34%)
proteasome_alpha_type_1 6..219 CDD:239718 75/216 (35%)
pas-3NP_001379751.1 proteasome_alpha_type_4 3..213 CDD:239721 75/216 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.