DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and pbs-4

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_491261.1 Gene:pbs-4 / 171975 WormBaseID:WBGene00003950 Length:202 Species:Caenorhabditis elegans


Alignment Length:160 Identity:31/160 - (19%)
Similarity:51/160 - (31%) Gaps:58/160 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VGLKNKDYAVLVALCKPTSELSDTQRKIIPIDDHLGISIAGLTADAR-----VLSRYLRSECLNY 95
            ||:..::|.:|.|                   |....:...:.||:.     .|.:.|...|:..
 Worm     8 VGISTENYVILAA-------------------DKATFAYGAILADSENDKEYRLGKKLTMMCIGE 53

  Fly    96 KHSYDTTYPVSRLITNLGNKMQTTTQRYDRRPYGVGLLVAGYDERGPHIYQVTPS-ATFFNCKAN 159
            :..          :...|:..:...|.|..|                :.|:|:|| |..|..::.
 Worm    54 EGD----------VAQFGDWTKRNLQLYSVR----------------NGYEVSPSCAHHFVRRSI 92

  Fly   160 SIGSRSQSART-------YLEKNLNKFLDS 182
            :.|.|||...|       |.:|....||.|
 Worm    93 AEGLRSQDHYTVDVLIGGYDDKEDKAFLGS 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 31/160 (19%)
proteasome_alpha_type_1 6..219 CDD:239718 31/160 (19%)
pbs-4NP_491261.1 proteasome_beta_type_2 4..199 CDD:239727 31/160 (19%)
PRE1 8..199 CDD:223711 31/160 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.