DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and psmb5

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_002941560.1 Gene:psmb5 / 100379732 XenbaseID:XB-GENE-975048 Length:257 Species:Xenopus tropicalis


Alignment Length:169 Identity:44/169 - (26%)
Similarity:75/169 - (44%) Gaps:16/169 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GTATVGLKNKDYAVLVALCKPTSE----LSDTQRKIIPIDDHLGISIAGLTADARVLSRYLRSEC 92
            ||.|:..|.: :.|:||:....:.    .|.|.:|:|.|:.:|..::||..||.....|.|..:|
 Frog    53 GTTTLAFKFR-HGVIVAVDSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQC 116

  Fly    93 LNYKHSYDTTYPV---SRLITNLGNKMQTTTQRYDRRPYGVGLLVAGYDERGPHIYQVTPSATFF 154
            ..|:........|   |:|:.|:       ..:|......:|.::.|:|:|||.:|.|.......
 Frog   117 RIYELRNKERISVAAASKLLANM-------VYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRV 174

  Fly   155 NCKANSIGSRSQSARTYLEKNLNKFLD-SSKDEIIRHGI 192
            :....|:||.|..|...|::..|..:: ....|:.|..|
 Frog   175 SGSVFSVGSGSMYAYGVLDRGYNYEMEVEEAQELARRSI 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 44/169 (26%)
proteasome_alpha_type_1 6..219 CDD:239718 44/169 (26%)
psmb5XP_002941560.1 proteasome_beta_type_5 54..241 CDD:239730 43/168 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.