DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha6 and psmb11b

DIOPT Version :9

Sequence 1:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001268731.1 Gene:psmb11b / 100331481 ZFINID:ZDB-GENE-170530-2 Length:362 Species:Danio rerio


Alignment Length:188 Identity:41/188 - (21%)
Similarity:70/188 - (37%) Gaps:57/188 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GTATVGLKNKDYAVLVA---------LCKPTSELSDTQRKIIPIDDHLGISIAGLTADA----RV 83
            ||.|:|...:...:..|         :..|.|.      |::||..||..:.:|.:||.    |:
Zfish   109 GTTTLGFAFQGGVIAAADTRSSCAGKVACPASP------KVLPIHSHLVGTTSGTSADCALWKRI 167

  Fly    84 LSRYLRSECLNYKHSYDTTYPVSRLITNL-----GNKM------------------QTTTQRY-- 123
            |:|.||...|.::... :|...::|::::     |.::                  |..|:||  
Zfish   168 LARELRLYQLRHRRRL-STGGAAKLLSHMLHPFKGTELCVAATLCGWDGDEDQDNEQPMTERYAN 231

  Fly   124 --------DRRPYGVGLLVAGYDERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLE 173
                    .:.....||  :|.  |||.:..|............|:||.|..|.:.|:
Zfish   232 TTLTSKSSSQSAASSGL--SGV--RGPRVVYVCSDGLRLQGALFSVGSGSPYAYSILD 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 41/188 (22%)
proteasome_alpha_type_1 6..219 CDD:239718 41/188 (22%)
psmb11bNP_001268731.1 proteasome_beta_type_5 110..333 CDD:239730 40/187 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.