DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4901 and Y108F1.5

DIOPT Version :9

Sequence 1:NP_001334733.1 Gene:CG4901 / 34357 FlyBaseID:FBgn0032194 Length:694 Species:Drosophila melanogaster
Sequence 2:NP_001361911.1 Gene:Y108F1.5 / 353490 WormBaseID:WBGene00022433 Length:147 Species:Caenorhabditis elegans


Alignment Length:148 Identity:55/148 - (37%)
Similarity:88/148 - (59%) Gaps:7/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 DGLRSAYKSLDALGAIKTGDDSYIT-PLGRQMVQYPLDPKYSKLLLTASSFGCMEEILSLVSVLS 521
            :||...|    |||||  .:.|.:| |||.||.::||.|.:||.||.::.|||..|::::|:::.
 Worm     3 NGLELLY----ALGAI--DETSQLTSPLGLQMAEFPLPPMHSKCLLKSAEFGCFTEMVTIVAMMQ 61

  Fly   522 SDHVFVSNSEKNEMAALAHAKFQSKHGDHLTLLNVFNGFLKSEKPKMWCHDNYLNLRSLTYARNV 586
            ...||::...:...|.:...||..:.|:|:|:||||..|:::.:.|.||.|:::|.|.|..|.||
 Worm    62 IQDVFITPYRQRHQADVIRKKFAVEEGNHITMLNVFTKFVENGRSKKWCSDHFVNYRGLMRADNV 126

  Fly   587 RRQLREISEHLHLALNSS 604
            |.||..:.:...:...||
 Worm   127 RSQLVRLLKRFEIEKVSS 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4901NP_001334733.1 None
Y108F1.5NP_001361911.1 HrpA <1..>144 CDD:224557 53/146 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000059
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.