powered by:
Protein Alignment CG5731 and SPCC757.06
DIOPT Version :9
Sequence 1: | NP_609354.1 |
Gene: | CG5731 / 34355 |
FlyBaseID: | FBgn0032192 |
Length: | 413 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_587681.1 |
Gene: | SPCC757.06 / 2538727 |
PomBaseID: | SPCC757.06 |
Length: | 116 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 75 |
Identity: | 19/75 - (25%) |
Similarity: | 32/75 - (42%) |
Gaps: | 18/75 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 123 YGNYTCAGYPGIIGYEEKDALQFADWNVDYVKLDGCYALPYDMDHG---YSTFGRLLNSTGKSMV 184
|..|||.||.|.:.::::|| :|...|| .:.:| |......||.|.:. :
pombe 11 YCKYTCCGYVGSLDHDKQDA---------HVCKLGC-----QLFYGESCYKEMSNALNGTSRP-I 60
Fly 185 YSCSWPVYQI 194
:..|.|..::
pombe 61 FLLSVPAIEV 70
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001285 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.