DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5731 and SPCC757.06

DIOPT Version :9

Sequence 1:NP_609354.1 Gene:CG5731 / 34355 FlyBaseID:FBgn0032192 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_587681.1 Gene:SPCC757.06 / 2538727 PomBaseID:SPCC757.06 Length:116 Species:Schizosaccharomyces pombe


Alignment Length:75 Identity:19/75 - (25%)
Similarity:32/75 - (42%) Gaps:18/75 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 YGNYTCAGYPGIIGYEEKDALQFADWNVDYVKLDGCYALPYDMDHG---YSTFGRLLNSTGKSMV 184
            |..|||.||.|.:.::::||         :|...||     .:.:|   |......||.|.:. :
pombe    11 YCKYTCCGYVGSLDHDKQDA---------HVCKLGC-----QLFYGESCYKEMSNALNGTSRP-I 60

  Fly   185 YSCSWPVYQI 194
            :..|.|..::
pombe    61 FLLSVPAIEV 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5731NP_609354.1 AmyAc_family 25..399 CDD:298606 19/75 (25%)
SPCC757.06NP_587681.1 AmyAc_family <15..>75 CDD:298606 17/71 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001285
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.