DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx17 and Snx31

DIOPT Version :9

Sequence 1:NP_609353.1 Gene:Snx17 / 34354 FlyBaseID:FBgn0032191 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_038936090.1 Gene:Snx31 / 366915 RGDID:1309483 Length:482 Species:Rattus norvegicus


Alignment Length:437 Identity:137/437 - (31%)
Similarity:212/437 - (48%) Gaps:65/437 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RMHFSIPDTQE------------LG------------------------SSPT---------YTA 24
            :|||.||.:|:            ||                        |||:         :..
  Rat     2 KMHFCIPVSQQQPDTLGGRYVVRLGPSVGWVGRGSVTLWSPSPIPPSPPSSPSIDNRDGCLCFQL 66

  Fly    25 YNIHINGIHHCVLRYKQLHSLNDQLRRHCVGVPLPPFPPKRLLPLTNGQLEARRSSLEQYLQAVG 89
            |:::::|...|.:||.|||..::|||| ..|..|||||||..|.:|...:|.||..||.|||.|.
  Rat    67 YSVYLDGFLFCKVRYSQLHRWDEQLRR-VFGNCLPPFPPKYYLAMTTTMVEERRGQLECYLQNVT 130

  Fly    90 QDNRLARSAHLQQFLQRAQLDTALAEGQVATDCEEQQLEVQVYTNPAGERILVNCSVQQNASALL 154
            .|.|:.||....:||...||.|.    .:.|    :.:.:.|:. |.|..|.|.......|..:|
  Rat   131 ADPRVTRSDVFTEFLTLVQLQTL----NITT----KNVVLAVFL-PDGRSINVGSLTSDTAERVL 186

  Fly   155 KSVCRELQLPDELVRFFCLFLVRRQRKSGELHLVRRLMDFESPY--ITRLHVQPCELLLRTCYWD 217
            :.|..:|.|..|||.:|.|||: :....|:|.:|::|.|||.||  :....|:.|::.||..|.|
  Rat   187 EVVAHKLGLHPELVGYFGLFLI-QCFPEGKLSVVKKLADFELPYTSLQSSEVENCKIGLRKWYLD 250

  Fly   218 SSRDAKLTGSKVALNLLYNQTVADVNREWVVICTPGEGRQLNSLQMQGRAREYMDLVRQLPSYGC 282
            .:.|:.|...:.|.:|||.|.|.||..||:. .|..:..:|.:||.|....::::|.:::..||.
  Rat   251 PAMDSVLMDCRAAGDLLYMQAVQDVEIEWMK-PTQAQREELKALQKQENQTKFLELSQKVQHYGN 314

  Fly   283 LQFDEAQVDYPEPDTMALISIGNKELALR-TARGVKIYETKFRVTRMRSWRVSVTHITLES---- 342
            :|.|....::|||....|:|.||.|::.. |....:..:..|:::|:|.|:|:.....|::    
  Rat   315 IQLDPCTCNHPEPGCGVLLSFGNNEISCHITLPDGQTQDIVFQMSRVRCWQVTSLGTLLDTDGPQ 379

  Fly   343 RLEPTHLQLAFEYLIGKQTLRWITINSDQAMLMSVCLQAMVDELLQR 389
            |....:|:|.|:|...... :|..|.|.||..:|.||:.||.|.:.:
  Rat   380 RTLNQNLELRFQYSEDSHQ-QWFVIYSKQAFFLSSCLKKMVSEKMAK 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx17NP_609353.1 PX_SNX17_31 7..108 CDD:132795 47/145 (32%)
FERM-like_C_SNX17 280..391 CDD:270145 35/115 (30%)
Snx31XP_038936090.1 PX_domain 4..149 CDD:413376 47/145 (32%)
Ubiquitin_like_fold 155..252 CDD:421700 33/102 (32%)
PH-like 313..427 CDD:418428 34/114 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6108
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D263172at33208
OrthoFinder 1 1.000 - - FOG0003603
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12431
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.