DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx17 and Snx27

DIOPT Version :9

Sequence 1:NP_609353.1 Gene:Snx17 / 34354 FlyBaseID:FBgn0032191 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_727023.1 Gene:Snx27 / 31493 FlyBaseID:FBgn0052758 Length:531 Species:Drosophila melanogaster


Alignment Length:397 Identity:98/397 - (24%)
Similarity:163/397 - (41%) Gaps:64/397 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SIPDTQELG-SSPTYTAYNIHINGIHHCVLRYKQLHSLNDQLRRHCVGVPLPPFPPKRLLPLTNG 72
            ||||...:. :...|..:|||:.|...|..||::..:|:..||:...|...|..|.|....|:..
  Fly   171 SIPDYGIVNRNGERYIVFNIHMAGRQLCSRRYREFANLHSLLRKEFSGFNFPKLPGKWPFQLSEQ 235

  Fly    73 QLEARRSSLEQYLQAVGQDNRLARSAHLQQFLQRAQLDTALAEGQVATDCEE----QQLEVQVYT 133
            ||:.||..|||||:.|.....:|.|..:|.||               ||.|:    ..::::|..
  Fly   236 QLDTRRRGLEQYLEKVCAVRVIAESDAVQDFL---------------TDTEDDISASPVDIKVML 285

  Fly   134 NPAGERILVNCSVQQNASALLKSVCRELQLPDELVRFFCLFLVRRQRKSGELHLVRRLMDFESPY 198
             |..|...|:.....||..:.:.:.:...|.....::|.||.:      .|.:..|:|...|.|:
  Fly   286 -PDHEVSTVSVKKSSNAQVVWEILVQRANLTAYTQQYFYLFEI------VEYNFERKLQPHEIPH 343

  Fly   199 ITRLHVQPCELLLRTCY----W--DSSRDAKLTGSKVALNLLYNQTVADVNREWVVICTPGEGR- 256
              :|:||.......||.    |  ..:::..|...:.|...::.|.|.:|||..:    ..:|| 
  Fly   344 --QLYVQNYSTASSTCLCVRRWLFSVAKELTLPDGEQAGRFIFYQAVDEVNRGNI----RADGRL 402

  Fly   257 -QLNSLQMQGRAREYMDLVRQLPSYGCLQFDEAQVDYPEPDTMALISIGNKELALRTARGVKIYE 320
             :|.:||...:|.:|:.|.|.||.||.:.|.....|            ..||..:..|.|:|   
  Fly   403 YELKALQDAKKAGDYLALARTLPGYGDVVFPHCSCD------------SRKEGHVVPAVGMK--- 452

  Fly   321 TKFRVTRMR---SWRVSVTHITLE----SRLEPTHLQLAFEYLIGKQTLRWITINSDQAMLMSVC 378
             .||:...|   |....:..:|.:    |..:...:...|:|....:..||:.:.:.....::.|
  Fly   453 -SFRLHACREDGSLEAQMVELTWDSITRSESDEESMSFCFQYNRPDKPARWVKVYTPYHAFLADC 516

  Fly   379 LQAMVDE 385
            ...:::|
  Fly   517 FDRIMEE 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx17NP_609353.1 PX_SNX17_31 7..108 CDD:132795 35/99 (35%)
FERM-like_C_SNX17 280..391 CDD:270145 21/113 (19%)
Snx27NP_727023.1 PDZ_signaling 46..138 CDD:238492
PX_SNX27 165..270 CDD:132796 36/113 (32%)
UBQ 278..363 CDD:294102 20/93 (22%)
FERM-like_C_SNX27 428..528 CDD:270146 20/112 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447371
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3784
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.