DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34159 and CG7841

DIOPT Version :10

Sequence 1:NP_001097137.1 Gene:CG34159 / 34353 FlyBaseID:FBgn0085188 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_648770.1 Gene:CG7841 / 39672 FlyBaseID:FBgn0036502 Length:174 Species:Drosophila melanogaster


Alignment Length:93 Identity:28/93 - (30%)
Similarity:37/93 - (39%) Gaps:40/93 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 QHDELIRYIRGAWIKVYEQGP------------PVLYCNES------------------------ 112
            ||:|:||||..:|..:..|.|            ||...|.:                        
  Fly    78 QHEEIIRYINDSWNMLVAQNPYDSSSSAKPVEKPVADANNNSAASPVESIMANSPVPAASTATVW 142

  Fly   113 ----DNQLKNFKPFDLEEYWGQRLVQNI 136
                ...|::|||||||.:||:||.|||
  Fly   143 VEPPSPALQDFKPFDLESWWGRRLFQNI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34159NP_001097137.1 FAM195 <83..136 CDD:464321 26/91 (29%)
CG7841NP_648770.1 FAM195 48..171 CDD:464321 28/93 (30%)

Return to query results.
Submit another query.