DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7 and rpmD

DIOPT Version :10

Sequence 1:NP_523531.1 Gene:RpL7 / 34352 FlyBaseID:FBgn0005593 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_417761.1 Gene:rpmD / 947797 ECOCYCID:EG10888 Length:59 Species:Escherichia coli


Alignment Length:45 Identity:14/45 - (31%)
Similarity:19/45 - (42%) Gaps:10/45 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KAEQREIKLRRLAKKRNQFYVPAEAKLAFVVRIRG-INKVAPKVR 109
            ||....:.|||:.....:...||         ||| ||.|:..|:
E. coli    21 KATLLGLGLRRIGHTVEREDTPA---------IRGMINAVSFMVK 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7NP_523531.1 uL30_euk 19..252 CDD:273548 14/45 (31%)
rpmDNP_417761.1 rpmD 2..59 CDD:180163 14/45 (31%)

Return to query results.
Submit another query.