DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL7 and RPL7B

DIOPT Version :9

Sequence 1:NP_001285794.1 Gene:RpL7 / 34352 FlyBaseID:FBgn0005593 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_015126.1 Gene:RPL7B / 855903 SGDID:S000006119 Length:244 Species:Saccharomyces cerevisiae


Alignment Length:243 Identity:122/243 - (50%)
Similarity:171/243 - (70%) Gaps:17/243 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PESKLKFSKKQISKRVAE---SKRRLKKAAVIALRKKEN----LVRAEKYQNEYIKAEQREIKLR 75
            |||:||.:|.|  ::.||   ::|..:|||     .||.    |.|...||.||..||:..|:.:
Yeast     9 PESQLKKTKAQ--QKTAEQIAAERAARKAA-----NKEKRAIILERNAAYQKEYETAERNIIQAK 66

  Fly    76 RLAKKRNQFYVPAEAKLAFVVRIRGINKVAPKVRKVLQLFRLRQINNGVFIKLNKATINMLRIAE 140
            |.||....:||.|:.||.|||||:||||:.||.||||||.||.:||:|.|:|:.|||:.:|::.|
Yeast    67 RDAKAAGSYYVEAQHKLVFVVRIKGINKIPPKPRKVLQLLRLTRINSGTFVKVTKATLELLKLIE 131

  Fly   141 PYITWGYPNLKSVRELIYKRGFVKHNRQRVPITDNFVIERKLRQAHQIQCVEDLVHEIFTVGPNF 205
            ||:.:|||:..::|:|:|||||.|.|:||||::||.:||..|.: :.|..::||:|||.||||:|
Yeast   132 PYVAYGYPSYSTIRQLVYKRGFGKINKQRVPLSDNAIIEANLGK-YGILSIDDLIHEIITVGPHF 195

  Fly   206 KYASNFLWPFKLNTPTGGW--RKKANHYVNGGDFGNREDQINRLLRKM 251
            |.|:||||||||:.|:|||  .:|..|::.||.|||||:.||:|::.|
Yeast   196 KQANNFLWPFKLSNPSGGWGVPRKFKHFIQGGSFGNREEFINKLVKAM 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL7NP_001285794.1 uL30_euk 19..252 CDD:273548 121/242 (50%)
Ribosomal_L30_N 20..90 CDD:285340 28/76 (37%)
Ribosomal_L7_archeal_euk 92..252 CDD:100099 91/162 (56%)
RPL7BNP_015126.1 uL30_euk 10..244 CDD:273548 121/242 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344206
Domainoid 1 1.000 133 1.000 Domainoid score I1108
eggNOG 1 0.900 - - E1_COG1841
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H87772
Inparanoid 1 1.050 238 1.000 Inparanoid score I700
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53947
OrthoFinder 1 1.000 - - FOG0001677
OrthoInspector 1 1.000 - - otm46661
orthoMCL 1 0.900 - - OOG6_100755
Panther 1 1.100 - - O PTHR11524
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1144
SonicParanoid 1 1.000 - - X1237
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.